DC-STAMP/TM7SF4 Antibody
| Name | DC-STAMP/TM7SF4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79329 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human TM7SF4The immunogen for this antibody is TM7SF4. Peptide sequence AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DCSTAMP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DC-STAMP/TM7SF4 Antibody [NBP1-79329] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24324_DC-STAMP-TM7SF4-Antibody-Western-Blot-NBP1-79329-img0003.jpg)
Western Blot: DC-STAMP/TM7SF4 Antibody [NBP1-79329] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.