MFNG Antibody

Name MFNG Antibody
Supplier Novus Biologicals
Catalog NBP1-79289
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human MFNG. Peptide sequence QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP.
Purity/Format Immunogen affinity purified
Blocking Peptide MFNG Blocking Peptide
Description Rabbit Polyclonal
Gene MFNG
Conjugate Unconjugated
Supplier Page Shop

Product images