MFNG Antibody

Name MFNG Antibody
Supplier Novus Biologicals
Catalog NBP1-79288
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig
Antigen Synthetic peptide directed towards the middle region of human MFNG (NP_002396). Peptide sequence MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene MFNG
Supplier Page Shop

Product images