CMYA3 Antibody
| Name | CMYA3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79271 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptide directed towards the C terminal of human XIRP2. Peptide sequence VEPPPRRPMSQKSEIHRANTSPSPPRSRSEQLVRLKDTTAKLSKGAIPCP. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | XIRP2 |
| Supplier Page | Shop |
Product images
![Western Blot: CMYA3 Antibody [NBP1-79271] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8954_CMYA3%2520Antibody-Western%2520Blot-NBP1-79271-img0003.jpg)
Western Blot: CMYA3 Antibody [NBP1-79271] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.