SMYD4 Antibody
| Name | SMYD4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79406 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Dog, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptide directed towards the N terminal of human SMYD4The immunogen for this antibody is SMYD4. Peptide sequence EGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDMSLCHANRSAALFHLGQYE. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SMYD4 |
| Supplier Page | Shop |
Product images
![Western Blot: SMYD4 Antibody [NBP1-79406] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8965_SMYD4%2520Antibody-Western%2520Blot-NBP1-79406-img0002.jpg)
Western Blot: SMYD4 Antibody [NBP1-79406] - 721_B cell lysate, concentration 0.2-1 ug/ml.