PHF20L1 Antibody

Name PHF20L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-79401
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Dog, Horse, Rabbit
Antigen Synthetic peptide directed towards the N terminal of human PHF20L1The immunogen for this antibody is PHF20L1. Peptide sequence AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PHF20L1
Supplier Page Shop

Product images