ZFYVE1 Antibody

Name ZFYVE1 Antibody
Supplier Novus Biologicals
Catalog NBP1-79427
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human ZFYVE1The immunogen for this antibody is ZFYVE1. Peptide sequence VCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZFYVE1
Conjugate Unconjugated
Supplier Page Shop

Product images