ZNF385B Antibody
| Name | ZNF385B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79420 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human ZNF385BThe immunogen for this antibody is ZNF385B. Peptide sequence HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF385B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF385B Antibody [NBP1-79420] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16181_ZNF385B%2520Antibody-Western%2520Blot-NBP1-79420-img0002.jpg)
Western Blot: ZNF385B Antibody [NBP1-79420] - Human Liver cell lysate, concentration 0.2-1 ug/ml.