ZNF618 Antibody

Name ZNF618 Antibody
Supplier Novus Biologicals
Catalog NBP1-79410
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptide directed towards the N terminal of human ZNF618The immunogen for this antibody is ZNF618. Peptide sequence TLGSYECGICGKKYKYYNCFQTHVRAHRDTEATSGEGASQSNNFRYTCDI.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ZNF618
Supplier Page Shop

Product images