ATP5H Antibody
| Name | ATP5H Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79479 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human ATP5HThe immunogen for this antibody is ATP5H. Peptide sequence CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ATP5H |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ATP5H Antibody [NBP1-79479] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6999_ATP5H%2520Antibody-Western%2520Blot-NBP1-79479-img0003.jpg)
![Western Blot: ATP5H Antibody [NBP1-79479] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7000_ATP5H-Antibody-Western-Blot-NBP1-79479-img0002.jpg)