CRAT Antibody
| Name | CRAT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79532 |
| Prices | $369.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human CRATThe immunogen for this antibody is CRAT. Peptide sequence MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CRAT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: CRAT Antibody [NBP1-79532] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7010_CRAT-Antibody-Western-Blot-NBP1-79532-img0002.jpg)
![Western Blot: CRAT Antibody [NBP1-79532] - Human HepG2, Liver, Testis Antibody Dilution: 2.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7011_CRAT%2520Antibody-Western%2520Blot-NBP1-79532-img0003.jpg)