PLEKHA7 Antibody
| Name | PLEKHA7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79526 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human PLEKHA7The immunogen for this antibody is PLEKHA7 (NP_778228). Peptide sequence PESRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PLEKHA7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PLEKHA7 Antibody [NBP1-79526] - HepG2 cell lysate 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15242_PLEKHA7%2520Antibody-Western%2520Blot-NBP1-79526-img0001.jpg)
Western Blot: PLEKHA7 Antibody [NBP1-79526] - HepG2 cell lysate 0.2-1 ug/ml