Fbl14 Antibody

Name Fbl14 Antibody
Supplier Novus Biologicals
Catalog NBP1-79520
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human FBXL14. Peptide sequence WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXL14
Conjugate Unconjugated
Supplier Page Shop

Product images