WBP4 Antibody
| Name | WBP4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79489 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | WBP4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: WBP4 Antibody [NBP1-79489] - Jurkat, Antibody Dilution: 1.0 ug/ml WBP4 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24644_WBP4%2520Antibody-Western%2520Blot-NBP1-79489-img0004.jpg)
![Western Blot: WBP4 Antibody [NBP1-79489] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24645_WBP4-Antibody-Western-Blot-NBP1-79489-img0003.jpg)