Opticin Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-79568
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the C terminal of human OPTCThe immunogen for this antibody is OPTC (NP_055174). Peptide sequence LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: OPTC
• Conjugate: Unconjugated