Lumican Antibody

Name Lumican Antibody
Supplier Novus Biologicals
Catalog NBP1-79555
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rabbit
Antigen Synthetic peptide directed towards the middle region of human LUM. Peptide sequence AFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LUM
Conjugate Unconjugated
Supplier Page Shop

Product images