SCFD2 Antibody
| Name | SCFD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79522 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | Synthetic peptide directed towards the middle region of human Scfd2The immunogen for this antibody is Scfd2. Peptide sequence LVSGLSSLCEHLGVREECFAVGPLSRVIATDLANYAPAKNRKKTATGRAS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | Scfd2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SCFD2 Antibody [NBP1-79522] - Mouse Kidney lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15286_SCFD2%2520Antibody-Western%2520Blot-NBP1-79522-img0002.jpg)
Western Blot: SCFD2 Antibody [NBP1-79522] - Mouse Kidney lysate, concentration 0.2-1 ug/ml.