Name | CCDC110 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79593 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the middle region of human CCDC110The immunogen for this antibody is CCDC110. Peptide sequence KEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQ. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CCDC110 |
Conjugate | Unconjugated |
Supplier Page | Shop |