TAF6L Antibody

Name TAF6L Antibody
Supplier Novus Biologicals
Catalog NBP1-74133
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Rat
Antigen Synthetic peptides corresponding to the middle region of Taf6l. Immunizing peptide sequence PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TAF6L
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.