GlyT1/SLC6A9 Antibody

Name GlyT1/SLC6A9 Antibody
Supplier Novus Biologicals
Catalog NBP1-74187
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to the C terminal of Slc6a9. Immunizing peptide sequence FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC6A9
Conjugate Unconjugated
Supplier Page Shop

Product images