RAB5C Antibody

Name RAB5C Antibody
Supplier Novus Biologicals
Catalog NBP1-74182
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to the C terminal of Rab5c. Immunizing peptide sequence FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB5C
Conjugate Unconjugated
Supplier Page Shop

Product images