Phosphoglucomutase 5 Antibody
| Name | Phosphoglucomutase 5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-74091 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to the N terminal of PGM5. Immunizing peptide sequence IPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLR. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PGM5 |
| Supplier Page | Shop |
Product images
![Western Blot: Phosphoglucomutase 5 Antibody [NBP1-74091] - Titration: 1.0 ug/ml Positive Control: Fetal Heart.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9060_Phosphoglucomutase%25205%2520Antibody-Western%2520Blot-NBP1-74091-img0003.jpg)
Western Blot: Phosphoglucomutase 5 Antibody [NBP1-74091] - Titration: 1.0 ug/ml Positive Control: Fetal Heart.