CAB39L Antibody

Name CAB39L Antibody
Supplier Novus Biologicals
Catalog NBP1-74079
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the N terminal of CAB39L. Immunizing peptide sequence EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CAB39L
Conjugate Unconjugated
Supplier Page Shop

Product images