ZC3H3 Antibody

Name ZC3H3 Antibody
Supplier Novus Biologicals
Catalog NBP1-74066
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Antigen Synthetic peptides corresponding to the N terminal of Zc3h3. Immunizing peptide sequence KEQLRRQIRLLQGLIDDYKTLHGNGPALGNSSATRWQPPMFPGGRTFGAR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Zc3h3
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.