ACOX3 Antibody
| Name | ACOX3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-74273 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to the C terminal of ACOX3. Immunizing peptide sequence SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ACOX3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ACOX3 Antibody [NBP1-74273] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14866_ACOX3-Antibody-Western-Blot-NBP1-74273-img0002.jpg)
Western Blot: ACOX3 Antibody [NBP1-74273] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.