ACAD9 Antibody

Name ACAD9 Antibody
Supplier Novus Biologicals
Catalog NBP1-74272
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the C terminal of ACAD9. Immunizing peptide sequence RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACAD9
Conjugate Unconjugated
Supplier Page Shop

Product images