FBXL20 Antibody

Name FBXL20 Antibody
Supplier Novus Biologicals
Catalog NBP1-74271
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the N terminal of FBXL20. Immunizing peptide sequence RTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXL20
Conjugate Unconjugated
Supplier Page Shop

Product images