HSDL1 Antibody

Name HSDL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-74267
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the C terminal of HSDL1. Immunizing peptide sequence STLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HSDL1
Conjugate Unconjugated
Supplier Page Shop

Product images