SPSB2 Antibody
| Name | SPSB2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-74266 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to the C terminal of SPSB2. Immunizing peptide sequence IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SPSB2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SPSB2 Antibody [NBP1-74266] - COLO205 Cell Lysate 1ug/ml Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19458_SPSB2-Antibody-Western-Blot-NBP1-74266-img0001.jpg)
Western Blot: SPSB2 Antibody [NBP1-74266] - COLO205 Cell Lysate 1ug/ml Gel Concentration 12%
![Immunohistochemistry: SPSB2 Antibody [NBP1-74266] - Rhesus macaque spinal cord Primary Antibody Dilution: 1 : 300 Secondary Antibody: Donkey anti Rabbit 488 Secondary Antibody Dilution: 1 : 500Color/Signal Descriptions: Green: SPSB2 Gene name: SPSB2 Submitted by: Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19459_SPSB2%2520Antibody-Immunohistochemistry-NBP1-74266-img0002.jpg)
Immunohistochemistry: SPSB2 Antibody [NBP1-74266] - Rhesus macaque spinal cord Primary Antibody Dilution: 1 : 300 Secondary Antibody: Donkey anti Rabbit 488 Secondary Antibody Dilution: 1 : 500Color/Signal Descriptions: Green: SPSB2 Gene name: SPSB2 Submitted by: Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706.