SLC22A14 Antibody

Name SLC22A14 Antibody
Supplier Novus Biologicals
Catalog NBP1-59398
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC22A14(solute carrier family 22, member 14) The peptide sequence was selected from the N terminal of SLC22A14. Peptide sequence IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC22A14
Conjugate Unconjugated
Supplier Page Shop

Product images