GMFG Antibody

Name GMFG Antibody
Supplier Novus Biologicals
Catalog NBP1-59299
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to GMFG(glia maturation factor, gamma) The peptide sequence was selected from the middle region of GMFG. Peptide sequence KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene GMFG
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.