OSGIN1 Antibody

Name OSGIN1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59296
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OSGIN1(oxidative stress induced growth inhibitor 1) The peptide sequence was selected from the N terminal of OSGIN1. Peptide sequence APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OSGIN1
Conjugate Unconjugated
Supplier Page Shop

Product images