DGCR2 Antibody

Name DGCR2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59283
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DGCR2(DiGeorge syndrome critical region gene 2) The peptide sequence was selected from the N terminal of DGCR2. Peptide sequence MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DGCR2
Conjugate Unconjugated
Supplier Page Shop

Product images