SLC35C1 Antibody

Name SLC35C1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59386
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to SLC35C1(solute carrier family 35, member C1) The peptide sequence was selected from the N terminal of SLC35C1. Peptide sequence TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene SLC35C1
Supplier Page Shop

Product images