Name | SLC35C1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59386 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to SLC35C1(solute carrier family 35, member C1) The peptide sequence was selected from the N terminal of SLC35C1. Peptide sequence TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG. |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | SLC35C1 |
Supplier Page | Shop |