ABCF3 Antibody

Name ABCF3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59381
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Rabbit
Antigen Synthetic peptides corresponding to ABCF3(ATP-binding cassette, sub-family F (GCN20), member 3) The peptide sequence was selected from the N terminal of ABCF3. Peptide sequence DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ABCF3
Supplier Page Shop

Product images