Name | ABCF3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59381 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Rabbit |
Antigen | Synthetic peptides corresponding to ABCF3(ATP-binding cassette, sub-family F (GCN20), member 3) The peptide sequence was selected from the N terminal of ABCF3. Peptide sequence DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | ABCF3 |
Supplier Page | Shop |