Name | PARP16 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59380 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to PARP16(poly (ADP-ribose) polymerase family, member 16) The peptide sequence was selected from the middle region of PARP16. Peptide sequence PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | PARP16 |
Supplier Page | Shop |