MDM1 Antibody

Name MDM1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59376
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MDM1(Mitochondrial deafness modifier 1) The peptide sequence was selected from the N terminal of MDM1. Peptide sequence GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MDM1
Conjugate Unconjugated
Supplier Page Shop

Product images