LMF2 Antibody

Name LMF2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59374
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LMF2(lipase maturation factor 2) The peptide sequence was selected from the middle region of LMF2. Peptide sequence YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LMF2
Conjugate Unconjugated
Supplier Page Shop

Product images