SLC6A15 Antibody

Name SLC6A15 Antibody
Supplier Novus Biologicals
Catalog NBP1-59366
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC6A15(solute carrier family 6, member 15) The peptide sequence was selected from the N terminal of SLC6A15. Peptide sequence DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC6A15
Conjugate Unconjugated
Supplier Page Shop

Product images