DULLARD Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59364
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DULLARD(dullard homolog (Xenopus laevis)) The peptide sequence was selected from the middle region of DULLARD. Peptide sequence HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CTDNEP1
• Conjugate: Unconjugated

Product images

Western Blot: DULLARD Antibody [NBP1-59364] - Human Lung.