TMCC1 Antibody

Name TMCC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59392
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMCC1(transmembrane and coiled-coil domain family 1) The peptide sequence was selected from the middle region of TMCC1. Peptide sequence YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMCC1
Conjugate Unconjugated
Supplier Page Shop

Product images