PMCA3 Antibody

Name PMCA3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59426
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP2B3(ATPase, Ca++ transporting, plasma membrane 3) The peptide sequence was selected from the N terminal of ATP2B3. Peptide sequence GDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP2B3
Conjugate Unconjugated
Supplier Page Shop

Product images