ZFYVE27 Antibody

Name ZFYVE27 Antibody
Supplier Novus Biologicals
Catalog NBP1-59421
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZFYVE27(zinc finger, FYVE domain containing 27) The peptide sequence was selected from the C terminal of ZFYVE27 (NP_001002261). Peptide sequence TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ZFYVE27
Conjugate Unconjugated
Supplier Page Shop

Product images