SURF4 Antibody
| Name | SURF4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59452 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SURF4(surfeit 4) The peptide sequence was selected from the N terminal of SURF4. Peptide sequence GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SURF4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SURF4 Antibody [NBP1-59452] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7413_SURF4-Antibody-Western-Blot-NBP1-59452-img0003.jpg)
![Western Blot: SURF4 Antibody [NBP1-59452] - Human fetal Lung lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7414_SURF4-Antibody-Western-Blot-NBP1-59452-img0002.jpg)