SC4MOL Antibody
| Name | SC4MOL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59450 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SC4MOL(sterol-C4-methyl oxidase-like) The peptide sequence was selected from the N terminal of SC4MOL (NP_006736). Peptide sequence MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | MSMO1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SC4MOL Antibody [NBP1-59450] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24915_SC4MOL-Antibody-Western-Blot-NBP1-59450-img0003.jpg)
![Western Blot: SC4MOL Antibody [NBP1-59450] - Human Liver cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24916_SC4MOL-Antibody-Western-Blot-NBP1-59450-img0002.jpg)