Metaxin 1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59449
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to MTX1(metaxin 1) The peptide sequence was selected from the C terminal of MTX1. Peptide sequence CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: MTX1
• Conjugate: Unconjugated

Product images

Western Blot: Metaxin 1 Antibody [NBP1-59449] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

Western Blot: Metaxin 1 Antibody [NBP1-59449] - Human Brain lysate, concentration 0.2-1 ug/ml.

Western Blot: Metaxin 1 Antibody [NBP1-59449] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: Metaxin 1 Antibody [NBP1-59449] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: Metaxin 1 Antibody [NBP1-59449] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.