CLDND1 Antibody

Name CLDND1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59441
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLDND1(claudin domain containing 1) The peptide sequence was selected from the middle region of CLDND1. Peptide sequence TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLDND1
Conjugate Unconjugated
Supplier Page Shop

Product images