CMTM2 Antibody

Name CMTM2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59439
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CMTM2(CKLF-like MARVEL transmembrane domain containing 2) The peptide sequence was selected from the N terminal of CMTM2. Peptide sequence DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CMTM2
Conjugate Unconjugated
Supplier Page Shop

Product images