MARVELD2 Antibody

Name MARVELD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59434
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MARVELD2(MARVEL domain containing 2) The peptide sequence was selected from the middle region of MARVELD2. Peptide sequence PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MARVELD2
Conjugate Unconjugated
Supplier Page Shop

Product images