VSIG3/IGSF11 Antibody

Name VSIG3/IGSF11 Antibody
Supplier Novus Biologicals
Catalog NBP1-59503
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to IGSF11(immunoglobulin superfamily, member 11) The peptide sequence was selected from the middle region of IGSF11. Peptide sequence EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene IGSF11
Supplier Page Shop

Product images